PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_36421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CO-like
Protein Properties Length: 414aa    MW: 45564.7 Da    PI: 5.6145
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_36421genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box193e-06444539
    zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                 C+ ++ ++   fC+++   lC +C  + H+       H++
  PEQU_36421  4 LCDFCGGQRSMVFCRSDAASLCLSCDRNVHSAnalsrrHSR 44
                7*****************************65667777765 PP

2zf-B_box26.51.4e-084689441
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                  C+++ +++++  C++ ++ lC++C  ++H +      H++ +
  PEQU_36421 46 LLCDRCFSQPATVRCTEERVSLCQNCDWNGHGNsilsseHKRLT 89
                68*****************************5588999998765 PP

3CCT64.33.6e-22360403144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 R +a++RYkeK+k RkFeKkirY+sRK++A+sR RvKGrFvk+ 
  PEQU_36421 360 RGNAVMRYKEKKKARKFEKKIRYASRKTRADSRRRVKGRFVKAG 403
                 7789*************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-10147IPR000315B-box-type zinc finger
PROSITE profilePS501199.997147IPR000315B-box-type zinc finger
CDDcd000211.02E-6447No hitNo description
PROSITE profilePS501199.1014390IPR000315B-box-type zinc finger
CDDcd000211.08E-54790No hitNo description
SMARTSM003360.524890IPR000315B-box-type zinc finger
PROSITE profilePS5101715.467360402IPR010402CCT domain
PfamPF062038.2E-17360402IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MASLCDFCGG QRSMVFCRSD AASLCLSCDR NVHSANALSR RHSRSLLCDR CFSQPATVRC  60
TEERVSLCQN CDWNGHGNSI LSSEHKRLTI SFYSGCPSAA ELAKIWPFVL EFPQIIDSSC  120
EQGIMGLMSI NENFSSTYLG PLRQSTSDMA DICKMNDVKI VKTTDVHFTS STATPTPMLC  180
STDHPTDSID STTPKSNDGT TKNVENCEDF YDGFDVEDEL TFENYEELFG ASHAHSEHLF  240
EDVGIDCLFE MKENSAANSN CQGEFVAEAS SANQVKSMQV ASSNAMSADS VMPSQGGKTE  300
YNMSISARQA HSSLSHTFSS LTGESSAGDY GDCGMSSMLL MGESPWYPTS SDISIQAANR  360
GNAVMRYKEK KKARKFEKKI RYASRKTRAD SRRRVKGRFV KAGEAFDYDP LSQS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800277.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10-like isoform X2
RefseqXP_008800278.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10-like isoform X2
RefseqXP_008800279.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10-like isoform X2
RefseqXP_008800280.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 10-like isoform X2
SwissprotQ9LUA91e-120COL10_ARATH; Zinc finger protein CONSTANS-LIKE 10
TrEMBLM9QS850.0M9QS85_9ASPA; CONSTANS-like 6
STRINGGLYMA20G07051.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20793788
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.11e-105B-box type zinc finger protein with CCT domain